litceysel.ru
добавить свой файл
1

www.diplomrus.ru ®

Авторское выполнение научных работ любой сложности – грамотно и в срок


Содержание

ОГЛАВЛЕНИЕ


1. ВВЕДЕНИЕ...-...4


1.1. Ранний нейрогенез моллюсков...5


1.2. Ранний нейрогенез аннелид,...7


1.3. Двигательные реакции личинок трохофорных животных и участие в них нейронов развивающейся нервной системы...8


1.4. Функции нейронов апикального органа в развитии...10


1.5. Цели и задачи исследования...12


2. МАТЕРИАЛ И МЕТОДИКА


2.1. Объекты исследования...13


2.2. Иммунохимическое маркирование...15


2.3. Глиоксилатная гистохимическая реакция...20


2.4. Формальдегид-глутаральдегидная реакция...20


2.5. Внутриклеточное окрашивание,...21


2.6. Объемная реконструкция серийных срезов...21


2.7. Электрофизиологические эксперименты,...21


2.8. Хроматография под высоким давлением (HPLC),...22


2.9. Радиоферментный анализ...22


2.10. Фармакологическая модуляция пищевого поведения...23


2.11. Фармакологическая модуляция развития...23


2.12. Регистрация поведения...24


2.13. Приготовление кондиционированной воды...24


2.14. Измерение размеров и статистическая обработка...25


3. РЕЗУЛЬТАТЫ ИССЛЕДОВАНИЯ И ОБСУЖДЕНИЕ


3.1. Нейрогенез пресноводных легочных моллюсков(Са8(горо(1а, Pulmonata)...26


3.1.1. Нормальное развитие...26


3.1.2. РМКРамид-иммунореактивные элементы у Lymnaea stagnalis, Biomphalaria glabrata и Helisoma trivolvis...27


3.1.3. Экспрессия пептидов семейства FMRFaMHfla в развитии Lymnaea stagnalis...33


3.1.4. Обсуждение...J...44

3.1.5. Серотонин-содержащи? нейроны у улиток семейств Lymnaeida и Planorbidae...50



3.1.6. Обсуждение...ff...53


3.1.7. Катехоламин-содержащие нейроны и катехоламин-зависимое поведение


в развитии/,, stagnalis,...55


3.1.7.1. Эмбриональное развитие...55


3.1.7.2. Постэмбриональное развитие...62


3.1.8. Обсуждение...73


3.1.9. Октопамин в эмбриональном и постэмбриональном развитии L. stagnalism...82


3.1.10. Октопамин как регулятор пищевого поведения у L. stagnalis...89


3.2. FMRFaiviivj-, серотонин- и катехоламин-содержащие нейроны в развитии Aplysia califomica (Gastropoda, Opisthobranchea)...97


3.2.1. Обсуждение...102


3.3. Локализация серотонина и его роль у ранних зародышей Т. diomedea...105


3.4. Нейрогенез хитона Ischnochiton hakodadensis (Polyplacophora),...113


3.4.1. Нормальное личиночное развитие...113


3.4.2. РМИРамид-содержащие нейроны...114


3.4.3. Серотонин-содержащие нейроны...117


3.4.4. Колокализация иммунореактивности к FMRFa и серотонину...121


3.4.5. Колокализация иммунореактивности к FMRFa и тубулину,...121


3.4.6. Обсуждение...123


3.5. Нейрогенез полихеты Phyllodoce maculata (Phyllodocidae)...127


3.5.1. Нормальное развитие...127


3.5.2. Серотонин-содержащие нейроны,...128


3.5.3. РМКРамид-содержащие нейроны...131


3.5.4. Каудальный сенсорный орган...134


3.5.4. Обсуждение...137


3.6. Сенсорная природа ранних нейронов...145


3.7. Роль нейронов задней полусферы в развитии...149


3.8. Роль нейронов апикального органа в развитии...152


3.8.1. Внутривидовая химическая сигнализация в эмбриональном развитии пресноводных пульмонат: роль ранних апикальных сенсорных нейронов...153

3.8.2. Обсуждение...161



4. ЗАКЛЮЧЕНИЕ...167


5. ВЫВОДЫ...176


6. СПИСОК ЛИТЕРАТУРЫ...178

Введение


1. ВВЕДЕНИЕ


При решении фундаментальных задач нейробиологии развития исследователи традиционно обращались к относительно просто устроенным модельным беспозвоночным. Данные последних лет, полученные нейробиологами развития с применением современных генетических и молекулярно-биологических методов при изучении эмбрионов модельных позвоночных и беспозвоночных, таких как мыши (Mus musculis), рыбы (Danio rerio), насекомые (Drosophila melanogaster) и нематоды {Caenorgabditis elegans) показали, что гены, регулирующие развитие, чаще всего являются консервативными у представителей даже далеко отстоящих таксономических групп (обзор Moody, 1999; Arendt et al., 2001, 2004). Эти открытия еще раз показали важность сравнительных исследований и подтвердили существовавшее и раньше представление о том, что фундаментальные механизмы развития едины во всем животном царстве.

Группа трохофорных животных, выделяемая по присутствию в их жизненном цикле трохофоры или трохофороподобной личинки, является одной из самых многочисленных среди Spiralia. Ее представители использовались в качестве экспериментальных моделей в различных областях биологии, и, в частности, нейробиологии. Так, доказательство роли серотонина (5НТ) как передатчика нервных импульсов было получено на садовой улитке Helix (Gershenfeld and Steni, 1965), а иитегративная функция этого медиатора в поведении была продемонстрирована на медицинской пиявке Herudo (Lent, 1986) и морском моллюске Clione limacina (Сахаров, Каботянский, 1986). Пептид Phe-Met-Arg-Phe-NH2 (FMRFamide) был изначально идентифицирован как возбуждающий сердечные сокращения у моллюсков (Price and Greenberg, 1977). На морских слизнях Tritonia и Aplysia была установлена и плодотворно изучается нейрональная основа поведения, памяти и обучения (Willows, 1967; Kandel, 1979, 2001). Множество работ посвящено изучению различных аспектов функционирования дефинитивной нервной системы моллюсков и аннелид. С другой стороны, их развитие давно и успешно изучается классическими эмбриологическими методами (напр., Raven, 1966; Cumin, 1972; Anderson, 1966; Мещеряков, 1975), которые затрагивают в числе прочих и развитие нервной системы. Тем не менее данные о нейрогенезе, и особенно о самых ранних его этапах, немногочисленны и порой противоречивы, а функции ларвальных нейронов все еще остаются на уровне предположений, и в большинстве случаев не имеют экспериментального подтверждения.



В последнее время все большее признание получает концептуальная модель функциональной значимости множественности нейротрансмиттеров (Сахаров, 1990).


Накапливаются факты, доказывающие, что поведение является трансмиттер-зависимым, то есть определенный трансмиттер может индуцировать комплексную интегрированную программу поведения целого организма (Livingstone et al., 1980; Kravitz, 1983; Sakharov, 1990). Однако вопрос о том, являются ли морфогенетические программы также трансмиттер-зависимыми, остается открытым. Было показано, что трансмиттеры присутствуют и являются функционально значимыми на ранних «донервных» стадиях развития (Бузников, 1987; Buznikov et al., 2001). Для более поздних стадий развития известно участие серотонина в метаморфозе и регуляции биения ресничек личинок (см. ссылки в главах 1.3 и 1.4). Период начальных этапов формирования нервной системы никогда не изучался с точки зрения участия нервных передатчиков в нейро- и онтогенезе.


Личинки трохофорных животных представляют удобную модель для решения подобных задач, так как обладают нервной системой, в которой представлено большинство медиаторов, характерных для дефинитивной ЦНС, и котороя, в то же время, состоит из небольшого числа нейронов (десятки), каждый из которых может быть идентифицирован.


1.1. Ранний нейрогенез моллюсков.

Представления, существующие до настоящего времени о нейрогенезе моллюсков, указывали на отличие в принципах развития этих животных от других известных беспозвоночных. Так, согласно ранним данным, полученным при применении световой микроскопии, считается, что закладка центральных ганглиев происходит путем инвагинации и последующей деламинации эктодермы пролиферативных зон, которое происходит на стадии перехода личинки со стадии трохофоры к стадии велигера. Первыми появляются парные церебральные плакоды, затем педальные плакоды (Raven, 1966; Morrill, 1982; Мещеряков, 1975). Вскоре после появления плакод начинается дифференцировка собственно соответствующих гаглиев (Cumin, 1972). Местонахождение пролиферативных зон ганглиев задней дуги не ясно, однако достоверно известно, что париетальные и висцеральный ганглии появляются позже церебральных. Последняя пара центральных ганглиев — буккальные — появляется незадолго до того как велигер претерпевает метаморфоз и превращается в ювенильное животное (Kriegstein, 1977). Таким образом, было общепринято, что ганглиогенез у моллюсков прогрессирует в ростро-каудальном направлении, а связывающие ганглии комиссуры и коннективы формируются путем роста отростков нейронов, дифференцирующихся внутри ганглиев.



Показано, что добавление клеток в места закладок центральных ганглиев, происходит исключительно путем миграции клеток постмитотических нейрональных предшественников, возникающих в периферических пролиферативных зонах, из которых произошли закладки ганглиев (McAllister et al., 1983; Jacob, 1984). Эти постмитотические клетки затем мигрируют внутрь и присоединяются к развивающимся гаглиям. Внутри же ганглиев обнаруживается пролиферация только глиальных клеток (Pentreath et al., 1985). Таким образом, в этом отношении нейрогенез моллюсков значительно отличается от известного для других беспозвоночных. Например, у насекомых и пиявок пролиферация эктодермальных клеток приводит к формированию крупных стволовых клеток-предшественников, которые претерпевают множественные асимметричные деления и дают начало серии меньших прогениторных клеток, которые продолжают делиться внутри развивающихся ганглиев центральной нервной системы (Weisblat et al., 1980; Doe and Goodman, 1985; Weisblat and Shankland, 1985). Также, в нейрогенезе моллюсков не было отмечено случаев смерти нейронов или их предшественников (Jacob, 1984; Marois and Carew, 1990), столь характерной для процесса регулировки числа нейронов в других таксономических группах. Например, около 50% потенциальных моторных нейронов, возникающих в спинном мозге позвоночных, подвергается запрограммированной клеточной гибели во время эмбриогенеза и на ранних постэмбриональных стадиях развития. Аналогичный процесс элиминации нейронов происходит и у пиявок, и у нематод (Schwartz at al., 1992; Oppenheim, 1999).

Последующие работы, включающие реконструкции эмбрионов на основе данных электронной микроскопии, добавили многие детали, пропущенные в предыдущих исследованиях, и показали необходимость выдвижения новых предположений, объясняющих, каким образом, чем, где и когда индуцируется дифференцировка будущих нервных структур (Kandel et al., 1981; Hickmott and Carew, 1991; Page, 1992, 1993). Однако это направление исследований было ограничено отсутствием адекватных, легко применяемых нейрон-специфичных маркеров, а также невозможностью исследования эмбриона целиком, а не на срезах. Развитие иммуноцитохимической методики и появление антител, специфически выявляющих нервные клетки выглядело очень обнадеживающим. Однако появившиеся достаточно многочисленные исследования с использованием антител против нейротрансмиттеров не внесли существенных изменений в классические представления о нейрогенезе моллюсков (Marois and Carew, 1990; Barlow and Truman, 1992; Marois and Croll, 1992; Kempf et al., 1987, 1992). Обнаруженные нервные клетки выявлялись в церебральных а



затем педальных ганглиях и ганглиях задней дуги в той же последовательности и в тот же период развития, как было описано в классических работах Равена (Raven, 1966) и Кумина (Cumin, 1972).


Таким образом, общепринято, что первые нейроны дифференцируются у моллюсков на стадии велигера, формирование ганглиев происходит в ростро-каудальном направлении, нейроны дифференцируются внутри ганглиев, и их отростки формируют связывающие ганглии коннективы и комиссуры. В раннем нейрогенезе моллюсков не были обнаружены такие принципиально важные для других беспозвоночных процессы, как прокладывание путей растущих нервов дефинитивной нервной системы отростками периферических пионерных нейронов (Goodman and Shatz. 1993), присутствие запрограммированной клеточной гибели и наличие транзиторных нейронов (см. ссылки выше).


1.2. Ранний нейрогенез аннелид.

Представленные в литературе данные о раннем нейрогенезе этой группы хотя и имеют более длительную историю, тем не менее малочисленны и во многом противоречивы. Клайненберг впервые описал нервную систему поздней трохофоры аннелиды Lopadorhynchus как состоящую из протрохального нерва, четырех больших мультиполярных нервных клеток и зачатка взрослого мозга в эписфере, и дорзо-медиального нерва в гипосфере (Kleinenberg, 1886). Однако впоследствии Майер (Meyer, 1901) и Бючли (Biitschli, 1912) описали сложный ортогон, состоящий из протрохального кольца, трех кольцевых нервов в эписфере, одного кольцевого нерва в гипосфере, и, как минимум, семи продольных нервов. Именно это описание ранней нервной системы аннелид вошло впоследствии во многие основные труды по сравнительной эмбриологии нервной системы (Беклемишев, 1964; Bullock and Horridge, 1965). Однако довольно быстро представление об ортогоне было опровергнуто. Все последующие исследователи описывают высокоцентрализованную нервную систему, состоящую из апикального органа, зачатков дефинитивного мозга в эписфере, выходящих из него в ростро-каудальном направлении продольных нервов, протрохального и окологлоточного колец (Akesson, 1967; Lacalli, 1984; Zavarzina and Tzetlin, 1991; Hay-Schmidt, 1995).



He существует также единого мнения по вопросу о взаимоотношении ранней (личиночной) и дефинитивной (взрослой) нервной системы. В литературе представлены две, диаметрально противоположных точки зрения. Так, согласно одной, дифинитивная нервная система развивается совершенно независимо от личиночной,


возникает из других источников, и ее нервы следуют по собственным, отличным от личиночных нервов, путям (Lacalli, 1984). В соответствии с другой точкой зрения большая часть личиночной нервной системы переходит во взрослую (Marois and Carew, 1990; Barlow and Truman, 1992; Zavarzina and Tzetlin, 1991; Hay-Schmidt, 1995; Сотников и др., 1994). Для решения этих вопросов выявление самых ранних нервных элементов и выяснение их судьбы в развитии является принципиально важным.


1.3. Двигательные реакции личинок трохофорных и участие в них нейронов развивающейся нервной системы.


Первые попытки изучения зародышей беспозвоночных относятся к концу XVII века и начинаются с описания явлений, доступных простому наблюдению, а именно, с описания двигательных реакций. Еще Сваммердам (Swammerdam, ум. 1685) в своей книге «Библия природы» приводит данные о многочисленных наблюдениях, произведенных им над эмбрионами различных улиток. Автор указывает, что еле заметные на глаз зародыши улиток производят внутри яйца быстрые вращательные движения.


Несколько позже и независимо от него аналогичное открытие обнародовал Левенгук (Lewenhock, 1722). В письме от 1 октября 1695 г., озаглавленном «О разоблачении тайн природы», Левенгук сообщает, что он с большим удивлением наблюдал, как непоявившиеся на свет зародыши моллюсков (Mollusquas acephales) с регулярностью совершают в яйце вращательные движения. «На каждом нерожденном моллюске, которого мы видели, - пишет Левенгук, - мы наблюдали эти феномены, которые были недоступны нашему разуму.»

Эти наблюдения голландских исследователей в течение многих десятилетий оставались неизвестными, и подобные сообщения в более позднее время все еще принимались за новые открытия. Так, Штибель (Stiebel, 1815) описал у зародышей прудовой улитки (Lymnaea stagnalis) две формы ритмических движений: 1) вращение зародыша вокруг собственной оси, без изменения положения в яйце, и 2) круговые движения зародыша с изменением положения в яйце. Первый тип движения возникает на 4-5-й день, а второй на 6-7-й день эмбриональной жизни; позже оба типа движений длительное время сосуществуют.



В том же направлении Карус (Cams, 1828) произвел многочисленные исследования на эмбрионах различных видов моллюсков (Unio, Anodonta, Lymnaea, Paludina и др.). Автор заметил, что ротаторные движения наблюдаются у эмбрионов на очень ранней стадии развития. Такие движения, когда эмбрион движется in toto без изменения своей


8


формы, в дальнейшем были предметом специального изучения многих авторов, они были описаны не только у многочисленных видов моллюсков, но и у других представителей мягкотелых (см. обзор Волохов, 1951). О причине этих движений в первое время ничего не было известно. Для объяснения их выдвигались самые невероятные предположения, порой даже мистического порядка. Правильное объяснение этим явлениям дал Грант (Grant, 1827), установив при изучении эмбрионов гастропод, что причиной вращения эмбриона является мерцание ресничек, расположенных на поверхности тела зародыша. Такое мерцательное движение считали первым признаком жизни эмбриона, так как оно появлялось значительно раньше, чем биения сердца. В дальнейшем было показано, что у зародышей Lymnaea stagnalis на определенной стадии развития, на фоне пассивных вращательных движений, формируются активные вытягивания головы и ноги, которые усиливаются по мере развития и приводят к разрыву окружающих оболочек и выходу из яйца. Прейер (Ргеуег, 1885) в своей монографии «Specielle Physiologie des Embryo» подробно излагает данные различных авторов о развитии подвижности у зародышей различных беспозвоночных. В то время вопрос о зависимости активных движений от развития нервной системы был не выяснен. Считалось, что активные сократительные движения появляются за счет автоматической деятельности эмбриональной мускулатуры, и лишь в дальнейшем появляются самостоятельные реакции, осуществляемые при участии ганглиев нервной системы (см. обзор Волохов, 1951).

В настоящее время общепринято, что именно личиночная нервная система осуществляет регуляцию и координацию двигательной активности личинок. Поведенческий репертуар личинок небогат и включает в себя, в основном, два типа ответов на внешние раздражители: 1) изменение частоты биения ресничек прототроха и\или ресничных шнуров, 2) мышечные сокращения тела и глотки. Давно известно, что паузы в биении ресничек появляются тогда, когда к ресничным клеткам подрастают нервные окончания. Последующие исследования установили, что реснички велюма у личинок некоторых моллюсков и аннелид иннервируются нейронами личиночного апикального органа (см., напр., Lacalli, 1984; Marois and Croll, 1992; Kempf at al., 1992, 1997). Экспериментально было показано, что экзогенный серотонин активируют локомоторные реснички личинок морских моллюсков (Koshtoyants et al., 1961; Diefenbach et al., 1991; Berias and Widdows, 1995). На зародыше пресноводной Helisoma установлено, что апикальные серотонинергические клетки усиливают выделение серотонина в ответ на гипоксию, вследствие чего ускоряется вращение зародыша внутри яйца (Goldberg and Kater, 1989; Diefenbach et al., 1991, 1995, 1998; Koss et al.,



2003). Автору не удалось найти в литературе данные об участии других нейронов развивающейся нервной системы в двигательных реакциях личинок.


1.4. Функции нейронов апикального органа в развитии.


Апикальный орган (АО) - клеточное образование плавающих личинок многих беспозвоночных животных, которое формируется с началом плавания и редуцируется после метаморфоза. АО имеется у представителей даже таких таксонов, которые считаются неродственными. Личинки, развитие которых модифицировано тем, что они не плавают и проходят метаморфоз внутри яйцевых оболочек, сохраняют свой АО. При всем многообразии форм развития беспозвоночных, АО неизменно расположен на аборальном полюсе личинки и включает султанчик чувствительных ресничек и лежащий в его основании комплекс сенсорных нейронов (например, Conklin, 1897; Беклемишев, 1964; Иванова-Казас, 1977; Nielsen, 2001). Уникальная эволюционная законсервированность АО свидетельствует о том, что он выполняет какую-то консервативную функцию, общую для разных личинок.

Десятилетия сравнительных и экспериментальных исследований не привели к формированию аргументированного взгляда на назначение АО. Про апикальный орган известно, что он участвует в оседании личинок и метаморфозе. Это предположение было впервые высказано на основании его сенсорной природы и местоположения относительно токов воды, создаваемых ресничками велюма (Conklin, 1897; Вопаг, 1978). Такой взгляд на функции АО впоследствии разделяли многие авторы (например, Chia and Rice, 1978; Lin and Leise, 1996; Hadfield et al., 2000; Leise at al., 2001). На связь АО с метаморфозом, действительно, указывают некоторые факты. У личинки моллюска Haliotis на ресничках апикального султанчика обнаружены рецепторы к фактору внешней среды - релизеру метаморфоза (Trapido-Rosenthal and Morse, 1986a, b; Wodicka and Morse, 1991; Baxter and Morse, 1992). Личинка моллюска Phestilla после разрушения лазером нейронов АО теряла способность отвечать на такие релизеры, хотя способности проходить метаморфоз при этом не теряла (Hadfield et al., 2000). Было показано, что различные экзогенные катехоламины, такие как адреналин, норадреналин, дофамин и его предшественник - L-DOPA, индуцируют метаморфоз у некоторых морских моллюсков (обзор Bonar et al., 1990; Beiras and Widdows, 1995; Boettcher and Targett, 1998). Уровень эндогенных катехоламинов: L-DOPA, дофамина и норэпинефрина, измеренный методом HPLC, повышается в процессе личиночного развития Phestilla и Crepidula. Экспериментальное снижение уровня норэпинефрина и



10


дофамина у Phestilla, и дофамина и L-DOPA у Crepidula, приводит к ингибированию метаморфоза, индуцированного естественными стимулами (Pires et al., 1997, 2000b).


Другие факты трудно совместить с представлением, что АО нужен исключительно для индукции метаморфоза. Так, АО полностью формируется значительно раньше центральных ганглиев и задолго (у разных видов от нескольких дней до нескольких недель) до готовности личинки к метаморфозу (Беклемишев, 1964; Иванова-Казас, 1977; Nielsen, 2001). В последние годы было показано, что среди сенсорных нейронов АО морских гастропод всегда присутствуют серотонинергические (обзор Page and Parries, 2000; Page, 2002), однако вызвать серотонином метаморфоз удалось только у одного из нескольких протестированных видов (Cooper and Leise, 1996). Кроме того, у некоторых видов АО частично дегенерирует уже на преметаморфных стадиях (Page, 2002b; Wanninger and Haszprunar, 2003).

На основании морфологических данных о наличии в АО трех различных типов сенсорных клеток, Chia и Koss (1984) предположили, что АО опосредует несколько типов поведения личинки: 1) ориентацию, 2) определение качества воды в мантийной полости, 3) ретракцию и протракцию велюма и цефалопедальной массы и 4) сортировку пищевых частиц. Лакалли (Lacalli, 1981, 1984, 1994) предположил, что АО может быть анцестральным фоторецептором, который во время нейрогенеза служит мишенью для растущих аксонов церебральной комиссуры. На основании детальных иммуноцитохимических и электронномикроскопических исследований структуры АО Кемпф с соавторами (Kempf et al., 1997) считают, что 1) нейропиль АО может служить местом выброса гормонов, которые влияют на личиночное поведение и\или развитие, 2) механорецепторные клетки осуществляют обратную связь, модулируя расположение лопастей прототроха, 3) серотонинергические компоненты АО модулируют активность мышц велюма. Однако до настоящего времени ни одно из этих предроложений, высказанных на основании анализа структуры элементов АО не получило экспериментального подтверждения.



Таким образом, даже по вопросу о функции нейронов апикального органа, который встречается практически у всех личинок трохофорных животных и, по-видимому, является гомологичным у всех представителей Trochozoa, который подробно изучается зоологами, эмбриологами и экспериментальными биологами в течение последних ста лет, и который представляет собой одну из немногих, если не единственную сенсорную структуру у развивающихся личинок, у исследователей до настоящего времени так и нет полного и аргументированного мнения.


11


1.5. Цели и задачи исследования.


Целью настоящей работы было выяснить стратегию нейрогенеза в различных группах трохофорных животных, применив современные методы клеточного маркирования. Сравнив нейрогенез репрезентативных представителей, выделить общие закономерности формирования личиночной нервной системы. Выяснить морфологические особенности и функциональные взаимодействия ранних нейронов между собой и с формирующейся дефинитивной нервной системой в случае каждого конкретного вида. Выявить роль, которую играют ранние нейроны в нейрогенезе, поведении и развитии.


В соответствии с этой целью были поставлены следующие задачи:


1. Выяснить, какие именно из моноаминов и пептидов семейства РМКБамида присутствуют в развивающихся зародышах гастропод и проследить динамику их экспрессии.


2. Максимально подробно изучить нейрогенез репрезентативных видов различных классов моллюсков и аннелид со времени появления первых нервных элементов до конца формирования ганглиев центральной нервной системы. Проследить судьбу выявленных идентифицированных нейронов.


3. Исследовать и сравнить особенности морфологии ранних нейронов у представителей различных групп трохофорных животных.


4. Исследовать значение ранней экспрессии серотонина в развитии гастропод.

5. Изучить роль идентифицированных октопамин-содержащих нейронов буккального ганглия в формировании пищевого ритма у гастропод.



6. Произвести фармакологическую модуляцию активности ранних нейронов и по возможности выявить естественные стимулы, влияющие на их активность.


7. Исследовать влияние изменения активности ранних нейронов на нейрогенез и развитие зародышей.


12


2. МАТЕРИАЛ И МЕТОДИКА


2.1. Объекты исследования.


Работа выполнена на личинках пресноводных и морских моллюсков и личинках морской полихеты. Эмбрионы пресноводных Lymnaea stagnalis, Helisoma trivolvis и Biomphalaria glabrata (Mollusca: Gastropoda: Pulmonata) получали из кладок, отложенных в лаборной популяции улиток. Коконы от морских Aplysia californica, Tritonia diomedea (Mollusca: Gastropoda: Opisthobranchea), Ischnochiton hakodadensis (Mollusca: Polyplacophora) и Phyllodoce maculata (Polychaeta: Phyllodocida) были получены от отловленных и содержащихся в аквариумах особей.


Половозрелых особей хитона Ischnochiton hakodadensis Pilsbry, 1892 (сем. Ischnochitonidae, подотряд Chitonina, отряд Chitonidae) собирали на литорали залива Восток Японского моря (биостанция «Восток» Института биологии моря Дальневосточного отделения Российской Академии Наук). Для получения половых продуктов применяли метод, впервые описанный Грейвом (Grave, 1932). Хитонов помещали в аквариум без аэрации. Для стимуляции выметывания гамет температуру воды поднимали с 18 до 22-23° С. Начавших нереститься особей отсаживали в отдельные емкости. После завершения нереста хитонов возвращали в аквариум. Яйцеклетки осеменяли суспензией спермиев (1 мл спермы на 10 мл морской воды). Развивающихся эмбрионов помещали в аквариумы с аэрацией при 19-21°С. За начало отсчета времени развития брали появление оболочки оплодотворения.

Половозрелых съедобных мидий (Mytilus edulis) собирали на территории морской фермы Aqua Prime (Ship Harbour, Nova Scotia, Canada). Нерест стимулировали повышением температуры на 8-10°С относительно окружающей. Подробно личиночное развитие мидии описано у Байн (Ваупе, 1971; Малахов, Медведева, 1985). Личинок содержали в пластиковых контейнерах объемом 50 л при 12 °С в течение 72 часов, до достижения фазы позднего велигера (стадия D). Затем личинок переносили в 1000 л контейнеры, заполненные морской водой при 12 °С, профильтрованной через фильтр с ячеей 0.2 мкм, которую меняли раз в 2-3 дня. Пищей личинкам служила культура водорослей lsochrysis galbana (клон ISO; Provasoli-Guillard Center for Culture of Marine Phytoplankton, West Boothbay Harbor, ME), добавляемая в концентрации 25000 клеток/мл после каждой смены воды.



Личинок гребешка Placopecten magellanicus получали непосредственно от компании по разведению гребешков (Fisheries Resource Development Corporation hatchery in Sandy Cove, Nova Scotia) и фиксировали для гистохимических исследований сразу после


13


доставки в лабораторию. Личиночное развитие P. magellanicus подробно описано в Culliney, 1974, и Cragg and Crisp, 1991. Перед фиксацией личинок изучали под микроскопом.


Половозрелых червей P. maculata L., 1767 собирали на литорали острова Средний (залив Чупа Белого моря, биостанция Ст-Петербургского Государственного Университета) и рассаживали попарно в аквариумы с аэрируемой фильтрованной морской водой (ФМВ) при 14-15°С. После того, как животные откладывали яйцевые коконы, коконы собирали, разрезали на кусочки длиной 4-6 мм и помещали в чашки Петри диаметром 90 мм в 15 мл ФМВ. Кроме того, яйцевые коконы собирали на литорали на стеблях морской травы зоостеры. После вылупления личинок их содержали в стеклянных стаканах объемом 200 мл (1-2 личинки на мл) при той же температуре.


Стадии развития личинок определяли по совокупности морфологических, морфометрических и поведенческих признаков, характерных для каждого вида. Для Lymnaea и Helisoma использовали как обозначение стадий по номеру (согласно Мещерякову, 1975), так и в процентах от общего времени эмбрионального развития, согласно Маруа и Кроллу (Marois and Croll, 1992), где 0% (эмбриональная стадия Е0) соответствует первому делению дробления, а 100% (Е100) соответствует вылуплению. Соотношение обозначения стадий представлено в Таблице 01.


номер стадии название стадии обозначение обозначение


в%


16 ранняя гаструла


17 средняя гаструла


18 поздняя гаструла


19 ранняя трохофора 20 Е20


20 средняя трохофора 25 Е25


21 поздняя трохофора 30 ЕЗО

22 ранний велигер 35 Е35



23 средний велигер 45 Е45


24 поздний велигер 55 Е55


«гиппо»


25 великонха 65 Е65


26 переход к ползанию 75 Е75


27 85 Е85


28 95 Е95


29 вылупление 100 Е100


Таблица 01. Соотношения обозначения стадий развития эмбрионов пресноводных пульмонат.


14


Стадии развития Lymnaea после выхода из кокона определяли, измеряя длину раковины. Выделяли следующие стадии постэмбрионального развития (Croll and Chiasson, 1989):


Стадия развития: Р1 Р2 РЗ Р4 Р5 Р6


Длина раковины (мм): 1.6-2.5 2.6-3.9 4.0-6.2 6.3-10.0 10.1-15.9 16-25


Для Aplysia californica и Tritonia diomedea использовали традиционное название стадий: ранняя, средняя, поздняя трохофора и ранний, средний, поздний велигер. Для Ischnochiton hakodadensis стадии развития указываются в часах после оплодотворения. Для Phyllodoce maculata время развития на стадиях до вылупления указывается в часах после появления первой борозды дробления. Для последующих стадий время указывается в часах после вылупления.


Для иммуногистохимического изучения и фармакологических экспериментов использовались зародыши начиная со стадии гаструлы, а также особи после вылупления различных стадий развития.


2.2. Иммунохимическое маркирование.


Для маркировки клеточных ресничек и цитоскелета нейрональных элементов использовались антитела против ацетилированного а-тубулина (Т), моноклональные, произведены в мыши, Sigma, USA.


Для иммунохимического маркирования нервных элементов использовались следующие антитела:


- серотонин (5НТ), поликлональные антитела, выработанные в кролике, (DiaSorin, Stillwater, США, # 20080).

- октопамин (ОА), моноклональные антитела, выработанные в кролике, любезно предоставлены доктором Эккертом (М. Eckert, Friedrich Schiller University, Jena, Germany).



- нейропептид FMRFaMHfl (Phe-Met-Arg-Phe-Nbh, FMRFa), поликлональные антитела, выработанные в кролике, (DiaSorin, Stillwater, США, # 20091).


- пентапептид ЕБЫНамид (EFLRIa), не-РМКЕамид-подобный 22-аминокислотный пептид SEQPDVDDYLRDVVLQSEELY ("SEEPLY") и 35-аминокислотный пептид SDPFFRFGKQQVATDDSGELDDEILSRVSDDDKNI ("acidic peptide") (Santama et al. 1993; Santama et al. 1995b; Santama et al. 1996), поликлональные антитела любезно предоставлены профессором Бенджамином (P.R. Benjamin, University of Sussex, Brighton, UK).


15


- миомодулин-подобный пептид CARP, поликлональные антитела, выработаны в кролике, любезно предоставлены доктором М. Ohtani (Hiroshima University, Higashi-Hiroshima, Japan).


- гамма-аминомаслянная кислота (GABA), поликлональные антитела, выработанные в мыши, Sigma, USA.


- фермент синтеза катехоламинов - тирозингидроксилаза (ТН), моноклональные антитела (Incstar, Stillwater, MN, США).


Первичные антитела выявляли при помощи вторичных антител против иммуноглобулинов кролика или мыши, меченных одним из следующих флуоресцентных маркеров: флуоресцеинизотиоцианат (FITC), родамин, Texas Red, Alexa-488, Alexa-546 (все Molecular Probes, USA). Для лазерной конфокальной микроскопии использовали только маркеры А1еха-488 и А1еха-546.


Для точного определения тел нейронов при иммунохимической реакции окрашивали ядра клеток. Для этого использовали флуоресцентные маркеры ДНК: йодистый пропидий и DAPI (Molecular Probes), которые добавляли в буфер для последней перед заключением промывки в концентрации соответственно 5 и 3 мкг/мл.

Нейроны выявляли на тотальных препаратах зародышей непрямым иммуноцитохимическим методом в модификации, оптимальной для соответствующих эмбрионов. Перед фиксацией личинок расслабляли постепенным добавлением в раствор 50 мкМ MgCb. На каждой стадии для каждого антитела изучали не меньше, чем по 100 зародышей каждого вида. В случае постэмбриональных стадий выделялись отдельно ЦНС, буккальная масса, пищевод, нога, мантия, губы, щупальца, половые органы. Иммуноцитохимическая реакция проводилась как тотально, так и на 50 мкм серийных срезах тканей, сделанных на замораживающем микротоме. Перед препарированием моллюсков анестезировали инъекцией 50 мкМ MgC^.



В общем случае личинок фиксировали 4-6 часов в 4% параформальдегиде в 0.1 М фосфатном буфере (ФБ, рН 7.4) (для выявления ОА фиксация проводилась в смеси: глутаральдегид - пикриновая кислота - ледяная уксусная кислота) при комнатной температуре (КТ), промывали 3 раза по 20 мин в ФБ, переносили в 30-50-70° этанол и хранили при -20°С (Dickinson et al., 1999). Для иммунохимии фиксации доводили до КТ, промывали в ФБ (3 х 20 мин) и блокировали места неспецифического связывания инкубацией в растворе, содержащем 10% нормальной козьей сыворотки, 0.25% бычьего сывороточного альбумина (БСА), 1-5% Triton Х-100 (ТХ), и 0.03% азида натрия в ФБ в течение ночи при 10°С.


16


Затем препараты инкубировали в растворе первичных антител против соответствующего вещества. Рабочее разведение составляло для аТ 1:500; a EFLRIa, a"acidic peptide", aOA, aGABA и aCARP 1:1000; а5НТ и a FMRFa 1:2000 - 1:3000, в блокирующем растворе. SEEPLY разводили в концентрации 1:200 в расторе, содержащем 50 мМ TRIS base, 150 мМ NaCl, 0.25% желатины и 1% ТХ-100 при рН 7.6 (Santama et al. 1993). Инкубацию проводили в течение трех дней при 10°С. Затем препараты промывали в ФБ (3 х 20 мин), инкубировали в растворе вторичных антител: goat-anti-rabbit IgG, коныогированные с Alexa 488 (Molecular Probes, Eugene, USA), разведение 1:300 в ФБ-ТХ в течение ночи при 10°С, промывали в ФБ (3 х 20 мин), помещали в 50% глицерин в ФБ на один час и заключали на предметные стекла в 80% глицерин в ФБ.


Для двойного мечения против FMRFa и серотонина препараты инкубировали последовательно с aFMRFa (1:2000, 3 дня при 10°С), goat-anti-rabbit Alexa 488 IgG (1:300, ночь при 10°С), а5НТ (1:3000, ночь при 10°С) и goat-anti-rabbit Alexa 546 IgG (Molecular Probes, 1:300, 5 часов при 10°С). После каждой инкубации следовала промывка в ФБ (3 х 30 min). Обратный порядок инкубации в первичных антителах (анти-серотонин, затем анти-FMRFa) приводил к идентичным результатам.

Для двойного мечения против FMRFa или серотонина и ацетилированного тубулина препараты инкубировали в смеси анти-FMRFa или анти-серотониновых антител (1:2000) и моноклональных антител против ацетилированного а-тубулина (anti-acety-lated cc-tubulin, произведены в мыши, Sigma, T-6793, разведение 1:200 в блокирующем растворе) в течение трех дней при 10°С, затем в смеси вторичных антител: goat-anti-rabbit Alexa 546 IgG (1:300) и goat-anti-mouse Alexa 488 IgG (Molecular Probes, 1:300) в течение ночи при 10°С. Затем препараты промывали и монтировали, как обычно.



Стандартные контроли включали замену антисыворотки на неимунную сыворотку. В контрольных препаратах никакого окрашивания не наблюдалось. Специфичность первичных антител против ОА, FMRFa, EFLRIa, SEEPLY, acidic peptide и CARP была ранее показана на ЦНС взрослых гастропод (Bright et al., 1993; Elekes et al., 1993; Fujiwara-Sakata et al. 1991; Hernadi et al. 1995; Santama et al. 1993, 1995b, 1996). Специфичность антител к серотонину, которые мы использовали, была ранее подтверждена на развивающихся эмбрионах различных гастропод (Croll and Chiasson, 1989; Croll and Voronezhskaya, 1996a; Marois and Carew, 1997a,b; Kempf at al., 1997; Dickinson et al., 1999).


Наши контроли дополнительно включали преинкубацию антител против CARP и EFLRIa в разведении 1:1000 вместе с 1мкг/мл синтетического CARP или EFLRIa, a также преинкубацию антител к серотонину с коньюгатом серотонин-БСА. Коньюгат


17

Список литературы